PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.B7KGV
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family EIL
Protein Properties Length: 621aa    MW: 69880.7 Da    PI: 5.1651
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.B7KGVgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3520.56.9e-159484201353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmw+d+m+lkrlke++k     ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+k
  Araip.B7KGV  48 DELERRMWRDKMRLKRLKEQSKA----KEG-IDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDK 140
                  79******************997....788.******************************************************************* PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyqa+n+i+++++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww++ gl+kdqg+ppyk
  Araip.B7KGV 141 VRFDRNGPAAIAKYQADNAIPGKNDGCNA-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGNEEWWPQIGLPKDQGPPPYK 237
                  ***************************88.******************************************************************** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkqspkvtlsceqkedvegkkesk 291
                  kphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++  ++ s+  +s ++++++ +++dv+g +++ 
  Araip.B7KGV 238 KPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPDycPPlSSGGGSGSLVINDCTEYDVDGAENEP 335
                  *******************************************************************863356667****************777777 PP

                  .XXXXXXXXXX...........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 292 ikhvqavktta...........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                    +v+ +k ++                           +++++rkrk   s+ + + +++ ++tc++ q+++se +l+f+d++s+++++
  Araip.B7KGV 336 NFDVEDRKPENlhpsnlgmrgrlqvqkpslpikgevvtNLDFIRKRK---SDFNLMVDQK-IYTCEHPQCPYSEGRLGFQDRSSRDNHQ 420
                  699**999999***********************************9...5555565665.5*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.5E-13148295No hitNo description
Gene3DG3DSA:1.10.3180.106.8E-77169305IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.7E-62174298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MMMFDDMGFC GDLDVLCGPL GESDMTARQT EPDAVVEDDY SDEEIDVDEL ERRMWRDKMR  60
LKRLKEQSKA KEGIDAAKQR QSQEQARRKK MSRAQDGILK YMLKMMEVCK AQGFVYGIIP  120
EKGKPVTGAS DNLREWWKDK VRFDRNGPAA IAKYQADNAI PGKNDGCNAI GPTPHTLQEL  180
QDTTLGSLLS ALMQHCDPPQ RRFPLEKGVP PPWWPTGNEE WWPQIGLPKD QGPPPYKKPH  240
DLKKAWKVGV LTAVIKHMSP DIAKIRKLVR QSKCLQDKMT AKESATWLAI INQEEALARE  300
LYPDYCPPLS SGGGSGSLVI NDCTEYDVDG AENEPNFDVE DRKPENLHPS NLGMRGRLQV  360
QKPSLPIKGE VVTNLDFIRK RKSDFNLMVD QKIYTCEHPQ CPYSEGRLGF QDRSSRDNHQ  420
LNCPYRNNSA ADFAGPNFHV NEVKPVIFPQ SYVQPNTTAQ PASLVPPTFD LTGLGVPEDG  480
QKMISDLMSI YDANVVGNKN TSSNNFVAEN QNQNIPQQCI NQQQESFFPN QGMVMEGNFF  540
ARDDNNQFDR FKAMNTPFET TTTAAATAVA TTNPPNNNNS NFNFMFGSPC DLGSFDFKED  600
LQGGMGMDSL HKQPDVSIWY Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-851733042133Protein ETHYLENE INSENSITIVE 3
4zds_B2e-851733042133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016166039.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0R4J4Z80.0A0A0R4J4Z8_SOYBN; Uncharacterized protein
STRINGGLYMA14G04550.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein